- MAT2B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82797
- PBS (pH 7.2) and 40% Glycerol
- Human, Rat
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- 0.1 ml (also 25ul)
- Unconjugated
- MAT2B
- This antibody was developed against Recombinant Protein corresponding to amino acids: MFDKVQFSNK SANMDHWQQR FPTHVKDVAT VCRQLAEKRM LDPSIKGTFH WSGNEQMTKY EMACAIADAF N
- Rabbit
- TGR, SDR23E1, MAT-II, Nbla02999, MATIIbeta
- methionine adenosyltransferase 2 non-catalytic beta subunit
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 38 kDa
- Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN
Specifications/Features
Available conjugates: Unconjugated